TCRmodel Logo

TCRmodel

Automated high resolution modeling of T cell receptors
TCRpMHC model viewer

Job ID : MHC1P4D_210914_100108
Status : Modeling completed

Download PDB file

Name Template PDB
Tcr α CDR1 5nmd_A
Tcr α CDR2-HV4 4zdh_A
Tcr α CDR3 1oga_D
Tcr α framework 4eup_G
Tcr α germline NA
Tcr β CDR1 4g9f_E
Tcr β CDR2-HV4 4g9f_E
Tcr β CDR3 5euo_F
Tcr β framework NA
Tcr β germline 4g9f_E
Peptide 4ftv
MHC I 4ftv
MHC II NA
TCR orientation 4ftv
pMHC orientation NA
TCRpMHC orientation 4ftv

Segments Template Alignment
CDR1α 5nmd_A
  •    Input:
  • TYSDRGSQSFF

  • Template:
  • TYSDRGSQSFF

  •          
CDR2α 4zdh_A
  •    Input:
  • MSIYSNGDKEDGRFTAQLNKASQYVS

  • Template:
  • MSIYSNGDKEDGRFTAQLNKASQYVS

  •          
CDR3α 1oga_D
  •    Input:
  • AVGGSQGNLI

  • Template:
  • AGAGSQGNLI

  •          
CDR1β 4g9f_E
  •    Input:
  • AQDMNHEYMS

  • Template:
  • AQDMNHEYMS

  •          
CDR2β 4g9f_E
  •    Input:
  • HYSVGAGITDQGEVPNGYNVSRSTTEDFP

  • Template:
  • HYSVGAGITDQGEVPNGYNVSRSTTEDFP

  •          
CDR3β 5euo_F
  •    Input:
  • ASSIRSSYEQY

  • Template:
  • ASSIRSSYEQY

  •          
Peptide 4ftv
  •    Input:
  • LLFGYPVYV

  • Template:
  • LLFGYPVYV

  •          

Name Sequence
Tcr α V domain VEQNSGPLSVPEGAIASLNCTYSDRGSQSFFWYRQYSGKSPELIMSIYSNGDKEDGRFTAQLNKASQYVSLLIRDSQPSDSATYLCAVGGSQGNLIFGKGTRVSTS
Tcr α framework VEQNSGPLSVPEGAIASLNCWYRQYSGKSPELILLIRDSQPSDSATYLCFGKGTRVSTS
Tcr α CDR1 TYSDRGSQSFF
Tcr α CDR2-HV4 MSIYSNGDKEDGRFTAQLNKASQYVS
Tcr α CDR3 AVGGSQGNLI
Tcr β V domain VTQTPKFQVLKTGQSMTLQCAQDMNHEYMSWYRQDPGMGLRLIHYSVGAGITDQGEVPNGYNVSRSTTEDFPLRLLSAAPSQTSVYFCASSIRSSYEQYFGQGTRLTVV
Tcr β framework VTQTPKFQVLKTGQSMTLQCWYRQDPGMGLRLILRLLSAAPSQTSVYFCFGQGTRLTVV
Tcr β CDR1 AQDMNHEYMS
Tcr β CDR2-HV4 HYSVGAGITDQGEVPNGYNVSRSTTEDFP
Tcr β CDR3 ASSIRSSYEQY
Peptide LLFGYPVYV
MHC1 α GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQ
MHC2 α NA
MHC2 β NA