TCRmodel Logo

TCRmodel

Automated high resolution modeling of T cell receptors
TCRpMHC model viewer

Job ID : MHC2AEW_210923_114643
Status : Modeling completed

Download PDB file

Name Template PDB
Tcr α CDR1 4gg6_E
Tcr α CDR2-HV4 4gg6_E
Tcr α CDR3 4gg6_E
Tcr α framework NA
Tcr α germline 4gg6_E
Tcr β CDR1 5ksa_D
Tcr β CDR2-HV4 5ksa_D
Tcr β CDR3 4gg6_F
Tcr β framework NA
Tcr β germline 5ksa_D
Peptide 4z7w
MHC I NA
MHC II 4z7w
TCR orientation 4z7w
pMHC orientation NA
TCRpMHC orientation 4z7w

Segments Template Alignment
CDR1α 4gg6_E
  •    Input:
  • NHSTISGTDYIH

  • Template:
  • NHSTISGTDYIH

  •          
CDR2α 4gg6_E
  •    Input:
  • IHGLTSNVNNRMASLAIAEDRKSST

  • Template:
  • IHGLTSNVNNRMASLAIAEDRKSST

  •          
CDR3α 4gg6_E
  •    Input:
  • ILRDGRGGADGLT

  • Template:
  • ILRDGRGGADGLT

  •          
CDR1β 5ksa_D
  •    Input:
  • SPRSGDLSVY

  • Template:
  • SPRSGDLSVY

  •          
CDR2β 5ksa_D
  •    Input:
  • IQYYNGEERAKGNILERFSAQQFPDLHSE

  • Template:
  • IQYYNGEERAKGNILERFSAQQFPDLHSE

  •          
CDR3β 4gg6_F
  •    Input:
  • ASSVAVSAGTYEQY

  • Template:
  • ASSVAVSAGTYEQY

  •          
Peptide 4z7w
  •    Input:
  • FQPSQENPQ

  • Template:
  • FQPSQENPQ

  •          

Name Sequence
Tcr α V domain KTTQPNSMESNEEEPVHLPCNHSTISGTDYIHWYRQLPSQGPEYVIHGLTSNVNNRMASLAIAEDRKSSTLILHRATLRDAAVYYCILRDGRGGADGLTFGKGTHLIIQ
Tcr α framework KTTQPNSMESNEEEPVHLPCWYRQLPSQGPEYVLILHRATLRDAAVYYCFGKGTHLIIQ
Tcr α CDR1 NHSTISGTDYIH
Tcr α CDR2-HV4 IHGLTSNVNNRMASLAIAEDRKSST
Tcr α CDR3 ILRDGRGGADGLT
Tcr β V domain VTQTPKHLITATGQRVTLRCSPRSGDLSVYWYQQSLDQGLQFLIQYYNGEERAKGNILERFSAQQFPDLHSELNLSSLELGDSALYFCASSVAVSAGTYEQYFGPGTRLTVT
Tcr β framework VTQTPKHLITATGQRVTLRCWYQQSLDQGLQFLLNLSSLELGDSALYFCFGPGTRLTVT
Tcr β CDR1 SPRSGDLSVY
Tcr β CDR2-HV4 IQYYNGEERAKGNILERFSAQQFPDLHSE
Tcr β CDR3 ASSVAVSAGTYEQY
Peptide FQPSQENPQ
MHC1 α NA
MHC2 α IVADHVASYGVNLYQSYGPSGQYSHEFDGDEEFYVDLERKETVWQLPLFRRFRRFDPQFALTNIAVLKHNLNIVIKRSNSTAAT
MHC2 β SPEDFVYQFKGMCYFTNGTERVRLVTRYIYNREEYARFDSDVGVYRAVTPLGPPAAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQR