TCRmodel Logo

TCRmodel

Automated high resolution modeling of T cell receptors
  • View
  • Cartoon
  • Sticks
  • CDR3 Sticks
  • Reset

Job ID : TCRS2XS_180718_160524
Status : Modeling completed

Download PDB file
Full model viewer

Name Template PDB
Tcr α CDR1 6AT6_A
Tcr α CDR2-HV4 6AT6_A
Tcr α CDR3 3REV_A
Tcr β CDR1 4JRY_E
Tcr β CDR2-HV4 5NMD_B
Tcr β CDR3 3QIU_D
Tcr orientation 6AVG

Segments Template Alignment
CDR1α 6AT6_A
  •    Input:
  • SHNNIATNDYIT

  • Template:
  • SHNNIATNDYIT

  •          
CDR2α 6AT6_A
  •    Input:
  • IQGYKTKVTNEVASLFIPADRKSST

  • Template:
  • IQGYKTKVTNEVASLFIPADRKSST

  •          
CDR3α 3REV_A
  •    Input:
  • CLVGDMDQAGTALIF

  • Template:
  • CAVRDMNSGNTPLVF

  •          
CDR1β 4JRY_E
  •    Input:
  • SPKSGHDTVS

  • Template:
  • SPKSGHDTVS

  •          
CDR2β 5NMD_B
  •    Input:
  • FQYYEEEERQRGNFPDRFSGHQFPNYSSE

  • Template:
  • FQYYEEEERQRGNFPDRFSGHQFPNYSSE

  •          
CDR3β 3QIU_D
  •    Input:
  • CASSLGQTNYGYTF

  • Template:
  • CASSLNNANSDYTF

  •          

Name Sequence
Tcr α V domain KTTQPISMDSYEGQEVNITCSHNNIATNDYITWYQQFPSQGPRFIIQGYKTKVTNEVASLFIPADRKSSTLSLPRVSLSDTAVYYCLVGDMDQAGTALIFGKGTTLSVS
Tcr α CDR1 SHNNIATNDYIT
Tcr α CDR2-HV4 IQGYKTKVTNEVASLFIPADRKSST
Tcr α CDR3 CLVGDMDQAGTALIF
Tcr β V domain VTQSPTHLIKTRGQQVTLRCSPKSGHDTVSWYQQALGQGPQFIFQYYEEEERQRGNFPDRFSGHQFPNYSSELNVNALLLGDSALYLCASSLGQTNYGYTFGSGTRLTVV
Tcr β CDR1 SPKSGHDTVS
Tcr β CDR2-HV4 FQYYEEEERQRGNFPDRFSGHQFPNYSSE
Tcr β CDR3 CASSLGQTNYGYTF