TCRmodel Logo

TCRmodel

Automated high resolution modeling of T cell receptors
  • View
  • Cartoon
  • Sticks
  • CDR3 Sticks
  • Reset

Job ID : TCRSDM6_180718_160348
Status : Modeling completed

Download PDB file
Full model viewer

Name Template PDB
Tcr α CDR1 6FUN_A
Tcr α CDR2-HV4 6FUN_A
Tcr α CDR3 4Z7W_E
Tcr β CDR1 1OGA_E
Tcr β CDR2-HV4 1OGA_E
Tcr β CDR3 4EI6_B
Tcr orientation 6FR7

Segments Template Alignment
CDR1α 6FUN_A
  •    Input:
  • NYSSSVSVYLF

  • Template:
  • NYSSSVPPYLF

  •          
CDR2α 6FUN_A
  •    Input:
  • LKYLSGSTLVESINGFEAEFNKSQTSFH

  • Template:
  • LKYTSAATLVKGINGFEAEFKKSETSFH

  •          
CDR3α 4Z7W_E
  •    Input:
  • CAVGGSQGNLIFF

  • Template:
  • CAVGETGANNLFF

  •          
CDR1β 1OGA_E
  •    Input:
  • EQNLNHDAMY

  • Template:
  • EQNLNHDAMY

  •          
CDR2β 1OGA_E
  •    Input:
  • YYSQIVNDFQKGDIAEGYSVSREKKESFP

  • Template:
  • YYSQIVNDFQKGDIAEGYSVSREKKESFP

  •          
CDR3β 4EI6_B
  •    Input:
  • CASSIRSSYEQYFF

  • Template:
  • CASSFWGAYAEQFF

  •          

Name Sequence
Tcr α V domain VTQLDSQVPVFEEAPVELRCNYSSSVSVYLFWYVQYPNQGLQLLLKYLSGSTLVESINGFEAEFNKSQTSFHLRKPSVHISDTAEYFCAVGGSQGNLIFFGKGTKLSVK
Tcr α CDR1 NYSSSVSVYLF
Tcr α CDR2-HV4 LKYLSGSTLVESINGFEAEFNKSQTSFH
Tcr α CDR3 CAVGGSQGNLIFF
Tcr β V domain ITQSPKYLFRKEGQNVTLSCEQNLNHDAMYWYRQDPGQGLRLIYYSQIVNDFQKGDIAEGYSVSREKKESFPLTVTSAQKNPTAFYLCASSIRSSYEQYFFGPGTRLTVT
Tcr β CDR1 EQNLNHDAMY
Tcr β CDR2-HV4 YYSQIVNDFQKGDIAEGYSVSREKKESFP
Tcr β CDR3 CASSIRSSYEQYFF